name: bio-sequence-properties description: Calculate sequence properties like GC content, molecular weight, isoelectric point, and GC skew using Biopython. Use when analyzing sequence composition, computing physical properties, or comparing sequences. tool_type: python primary_tool: Bio.SeqUtils measurable_outcome: Execute skill workflow successfully with valid output within 15 minutes. allowed-tools:

• read_file
• run_shell_command

Sequence Properties

Calculate physical and chemical properties of biological sequences using Biopython.

Required Imports

from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction, molecular_weight, GC123, GC_skew, nt_search, seq1, seq3
from Bio.SeqUtils.ProtParam import ProteinAnalysis

DNA/RNA Properties

GC Content

from Bio.SeqUtils import gc_fraction

seq = Seq('ATGCGATCGATCGATCGATCG')
gc = gc_fraction(seq)  # Returns 0.476... (fraction)
gc_percent = gc * 100  # Convert to percentage

Handle ambiguous bases:

gc = gc_fraction(seq, ambiguous='ignore')  # Ignore N bases in calculation
gc = gc_fraction(seq, ambiguous='weighted')  # Weight by probability

GC at Codon Positions (GC123)

Analyze GC content at each codon position (useful for codon bias analysis):

from Bio.SeqUtils import GC123

seq = Seq('ATGCGATCGATCGATCGATCG')
gc_total, gc_pos1, gc_pos2, gc_pos3 = GC123(seq)
# gc_total: overall GC%
# gc_pos1: GC% at 1st codon position
# gc_pos2: GC% at 2nd codon position
# gc_pos3: GC% at 3rd codon position (wobble)

GC Skew

Calculate (G-C)/(G+C) in sliding windows to identify replication origins:

from Bio.SeqUtils import GC_skew

seq = Seq('ATGCGATCGATCGATCGATCG' * 10)
skew_values = GC_skew(seq, window=100)  # Returns list of skew values

Molecular Weight

from Bio.SeqUtils import molecular_weight

dna = Seq('ATGCGATCG')
mw = molecular_weight(dna)  # Single-stranded DNA weight

# Double-stranded DNA
mw_ds = molecular_weight(dna, double_stranded=True)

# Circular DNA
mw_circ = molecular_weight(dna, circular=True)

# RNA
rna = Seq('AUGCGAUCG')
mw_rna = molecular_weight(rna, seq_type='RNA')

# Protein
protein = Seq('MRCRS')
mw_prot = molecular_weight(protein, seq_type='protein')

Melting Temperature

from Bio.SeqUtils import MeltingTemp

seq = Seq('ATGCGATCGATCG')

# Basic Tm (Wallace rule - short oligos)
tm_wallace = MeltingTemp.Tm_Wallace(seq)

# GC method (more accurate for longer sequences)
tm_gc = MeltingTemp.Tm_GC(seq)

# Nearest neighbor (most accurate)
tm_nn = MeltingTemp.Tm_NN(seq)

# With salt correction
tm_corrected = MeltingTemp.Tm_NN(seq, Na=50, Mg=1.5)

Sequence Search with IUPAC Codes (nt_search)

Built-in search that handles IUPAC ambiguity codes:

from Bio.SeqUtils import nt_search

seq = 'ATGCGATCGATCGATNGATC'
# Search for pattern with ambiguous bases
result = nt_search(seq, 'GATNGATC')  # N matches any base
# Returns: ['GATNGATC', 8] - pattern and position(s)

Base Composition

def base_composition(seq):
    seq_str = str(seq).upper()
    total = len(seq_str)
    return {base: seq_str.count(base) / total * 100 for base in 'ATGC'}

Amino Acid Code Conversion

Convert between 1-letter and 3-letter amino acid codes:

from Bio.SeqUtils import seq1, seq3

# 3-letter to 1-letter
one_letter = seq1('MetAlaGlyTrp')  # Returns 'MAGW'

# 1-letter to 3-letter
three_letter = seq3('MAGW')  # Returns 'MetAlaGlyTrp'

# With custom separator
three_letter = seq3('MAGW', join='-')  # Returns 'Met-Ala-Gly-Trp'

Protein Properties

Using ProteinAnalysis

from Bio.SeqUtils.ProtParam import ProteinAnalysis

protein = ProteinAnalysis('MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNG')

Basic Properties

mw = protein.molecular_weight()           # Molecular weight in Daltons
pi = protein.isoelectric_point()          # Isoelectric point
aa_comp = protein.amino_acids_percent     # Amino acid composition (property)
aa_count = protein.count_amino_acids()    # Raw amino acid counts

Stability and Hydropathy

instability = protein.instability_index()  # < 40 = stable, > 40 = unstable
gravy = protein.gravy()                    # Negative = hydrophilic, Positive = hydrophobic
arom = protein.aromaticity()               # Fraction of Phe+Trp+Tyr

Charge at Specific pH

charge = protein.charge_at_pH(7.0)  # Net charge at pH 7.0
charge_acidic = protein.charge_at_pH(4.0)
charge_basic = protein.charge_at_pH(10.0)

Flexibility Profile

flexibility = protein.flexibility()  # List of flexibility values per residue
# Based on Vihinen, 1994 scale

Secondary Structure

helix, turn, sheet = protein.secondary_structure_fraction()

Extinction Coefficient

eps_reduced, eps_cystine = protein.molar_extinction_coefficient()
# eps_reduced: all Cys are reduced
# eps_cystine: all Cys form disulfide bonds

Protein Scale Profiles

Calculate profiles using any amino acid scale:

# Kyte-Doolittle hydropathy profile
kd_scale = {'A': 1.8, 'R': -4.5, 'N': -3.5, ...}
profile = protein.protein_scale(kd_scale, window=7)

Code Patterns

Analyze Multiple Sequences

from Bio import SeqIO
from Bio.SeqUtils import gc_fraction

def analyze_fasta(filename):
    results = []
    for record in SeqIO.parse(filename, 'fasta'):
        results.append({
            'id': record.id,
            'length': len(record.seq),
            'gc': gc_fraction(record.seq) * 100
        })
    return results

GC Content Distribution (Sliding Windows)

from Bio.SeqUtils import gc_fraction

def gc_distribution(seq, window_size=100, step=50):
    gc_values = []
    for i in range(0, len(seq) - window_size + 1, step):
        window = seq[i:i + window_size]
        gc_values.append((i, gc_fraction(window) * 100))
    return gc_values

GC Skew Plot Data

from Bio.SeqUtils import GC_skew

def gc_skew_analysis(seq, window=1000):
    skew = GC_skew(seq, window=window)
    positions = list(range(0, len(seq) - window + 1, window))
    cumulative = []
    total = 0
    for s in skew:
        total += s
        cumulative.append(total)
    return positions, skew, cumulative

Full Protein Analysis Report

from Bio.SeqUtils.ProtParam import ProteinAnalysis

def protein_report(sequence):
    protein = ProteinAnalysis(str(sequence).replace('*', ''))
    helix, turn, sheet = protein.secondary_structure_fraction()
    return {
        'length': len(sequence),
        'molecular_weight': protein.molecular_weight(),
        'isoelectric_point': protein.isoelectric_point(),
        'charge_at_pH7': protein.charge_at_pH(7.0),
        'instability_index': protein.instability_index(),
        'gravy': protein.gravy(),
        'aromaticity': protein.aromaticity(),
        'helix_fraction': helix,
        'turn_fraction': turn,
        'sheet_fraction': sheet,
    }

Dinucleotide Frequencies

from collections import Counter

def dinucleotide_freq(seq):
    seq_str = str(seq)
    dinucs = [seq_str[i:i+2] for i in range(len(seq_str) - 1)]
    counts = Counter(dinucs)
    total = sum(counts.values())
    return {di: count / total for di, count in counts.items()}

CpG Observed/Expected Ratio

def cpg_ratio(seq):
    seq_str = str(seq).upper()
    cpg = seq_str.count('CG')
    c = seq_str.count('C')
    g = seq_str.count('G')
    expected = (c * g) / len(seq_str) if len(seq_str) > 0 else 0
    return cpg / expected if expected > 0 else 0

Property Reference

DNA/RNA Properties

gc_fraction()

GC123()

GC_skew()

molecular_weight()

MeltingTemp.Tm_*()

nt_search()

Protein Properties

molecular_weight()

isoelectric_point()

charge_at_pH(pH)

instability_index()

gravy()

aromaticity()

flexibility()

Amino Acid Codes

seq1()

seq3()

Common Errors

KeyError

Decision Tree

Need sequence properties?
├── DNA/RNA sequence?
│   ├── GC content? → gc_fraction()
│   ├── GC at codon positions? → GC123()
│   ├── GC skew (replication origin)? → GC_skew()
│   ├── Molecular weight? → molecular_weight()
│   ├── Melting temperature? → MeltingTemp.Tm_NN()
│   └── Search with IUPAC codes? → nt_search()
├── Protein sequence?
│   └── Create ProteinAnalysis object
│       ├── Size → molecular_weight()
│       ├── Charge → isoelectric_point(), charge_at_pH()
│       ├── Stability → instability_index()
│       ├── Hydrophobicity → gravy()
│       ├── Flexibility → flexibility()
│       └── Structure → secondary_structure_fraction()
└── Convert amino acid codes?
    └── seq1() / seq3()

Related Skills

• seq-objects - Create Seq objects for property calculation
• sequence-io/sequence-statistics - File-level statistics (N50, totals)
• codon-usage - GC123 for codon position analysis
• transcription-translation - Translate before protein analysis
• alignment-files/bam-statistics - samtools stats for alignment-level GC and quality stats