BioSkills bio-sequence-properties
Calculate sequence properties like GC content, molecular weight, isoelectric point, and GC skew using Biopython. Use when analyzing sequence composition, computing physical properties, or comparing sequences.
git clone https://github.com/GPTomics/bioSkills
T=$(mktemp -d) && git clone --depth=1 https://github.com/GPTomics/bioSkills "$T" && mkdir -p ~/.claude/skills && cp -r "$T/sequence-manipulation/sequence-properties" ~/.claude/skills/gptomics-bioskills-bio-sequence-properties && rm -rf "$T"
sequence-manipulation/sequence-properties/SKILL.mdVersion Compatibility
Reference examples tested with: BioPython 1.83+, samtools 1.19+
Before using code patterns, verify installed versions match. If versions differ:
- Python:
thenpip show <package>
to check signatureshelp(module.function)
If code throws ImportError, AttributeError, or TypeError, introspect the installed package and adapt the example to match the actual API rather than retrying.
Sequence Properties
Calculate physical and chemical properties of biological sequences using Biopython.
"Calculate GC content" → Compute the fraction of G+C bases in a nucleotide sequence.
- Python:
(BioPython SeqUtils)gc_fraction(seq)
"Analyze protein properties" → Compute MW, pI, stability, hydrophobicity from an amino acid sequence.
- Python:
(BioPython ProtParam)ProteinAnalysis(str_seq)
Required Imports
from Bio.Seq import Seq from Bio.SeqUtils import gc_fraction, molecular_weight, GC123, GC_skew, nt_search, seq1, seq3 from Bio.SeqUtils.ProtParam import ProteinAnalysis
DNA/RNA Properties
GC Content
from Bio.SeqUtils import gc_fraction seq = Seq('ATGCGATCGATCGATCGATCG') gc = gc_fraction(seq) # Returns 0.476... (fraction) gc_percent = gc * 100 # Convert to percentage
Handle ambiguous bases:
gc = gc_fraction(seq, ambiguous='ignore') # Ignore N bases in calculation gc = gc_fraction(seq, ambiguous='weighted') # Weight by probability
GC at Codon Positions (GC123)
Analyze GC content at each codon position (useful for codon bias analysis):
from Bio.SeqUtils import GC123 seq = Seq('ATGCGATCGATCGATCGATCG') gc_total, gc_pos1, gc_pos2, gc_pos3 = GC123(seq) # gc_total: overall GC% # gc_pos1: GC% at 1st codon position # gc_pos2: GC% at 2nd codon position # gc_pos3: GC% at 3rd codon position (wobble)
GC Skew
Calculate (G-C)/(G+C) in sliding windows to identify replication origins:
from Bio.SeqUtils import GC_skew seq = Seq('ATGCGATCGATCGATCGATCG' * 10) skew_values = GC_skew(seq, window=100) # Returns list of skew values
Molecular Weight
from Bio.SeqUtils import molecular_weight dna = Seq('ATGCGATCG') mw = molecular_weight(dna) # Single-stranded DNA weight # Double-stranded DNA mw_ds = molecular_weight(dna, double_stranded=True) # Circular DNA mw_circ = molecular_weight(dna, circular=True) # RNA rna = Seq('AUGCGAUCG') mw_rna = molecular_weight(rna, seq_type='RNA') # Protein protein = Seq('MRCRS') mw_prot = molecular_weight(protein, seq_type='protein')
Melting Temperature
from Bio.SeqUtils import MeltingTemp seq = Seq('ATGCGATCGATCG') # Basic Tm (Wallace rule - short oligos) tm_wallace = MeltingTemp.Tm_Wallace(seq) # GC method (more accurate for longer sequences) tm_gc = MeltingTemp.Tm_GC(seq) # Nearest neighbor (most accurate) tm_nn = MeltingTemp.Tm_NN(seq) # With salt correction tm_corrected = MeltingTemp.Tm_NN(seq, Na=50, Mg=1.5)
Sequence Search with IUPAC Codes (nt_search)
Built-in search that handles IUPAC ambiguity codes:
from Bio.SeqUtils import nt_search seq = 'ATGCGATCGATCGATNGATC' # Search for pattern with ambiguous bases result = nt_search(seq, 'GATNGATC') # N matches any base # Returns: ['GATNGATC', 8] - pattern and position(s)
Base Composition
def base_composition(seq): seq_str = str(seq).upper() total = len(seq_str) return {base: seq_str.count(base) / total * 100 for base in 'ATGC'}
Amino Acid Code Conversion
Convert between 1-letter and 3-letter amino acid codes:
from Bio.SeqUtils import seq1, seq3 # 3-letter to 1-letter one_letter = seq1('MetAlaGlyTrp') # Returns 'MAGW' # 1-letter to 3-letter three_letter = seq3('MAGW') # Returns 'MetAlaGlyTrp' # With custom separator three_letter = seq3('MAGW', join='-') # Returns 'Met-Ala-Gly-Trp'
Protein Properties
Goal: Compute physical and chemical properties of a protein from its amino acid sequence.
Approach: Create a
ProteinAnalysis object, then call property methods. Remove stop codons (*) and non-standard residues (X) before analysis.
Using ProteinAnalysis
from Bio.SeqUtils.ProtParam import ProteinAnalysis protein = ProteinAnalysis('MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNG')
Basic Properties
mw = protein.molecular_weight() # Molecular weight in Daltons pi = protein.isoelectric_point() # Isoelectric point aa_comp = protein.amino_acids_percent # Amino acid composition (property) aa_count = protein.count_amino_acids() # Raw amino acid counts
Stability and Hydropathy
instability = protein.instability_index() # < 40 = stable, > 40 = unstable gravy = protein.gravy() # Negative = hydrophilic, Positive = hydrophobic arom = protein.aromaticity() # Fraction of Phe+Trp+Tyr
Charge at Specific pH
charge = protein.charge_at_pH(7.0) # Net charge at pH 7.0 charge_acidic = protein.charge_at_pH(4.0) charge_basic = protein.charge_at_pH(10.0)
Flexibility Profile
flexibility = protein.flexibility() # List of flexibility values per residue # Based on Vihinen, 1994 scale
Secondary Structure
helix, turn, sheet = protein.secondary_structure_fraction()
Extinction Coefficient
eps_reduced, eps_cystine = protein.molar_extinction_coefficient() # eps_reduced: all Cys are reduced # eps_cystine: all Cys form disulfide bonds
Protein Scale Profiles
Calculate profiles using any amino acid scale:
# Kyte-Doolittle hydropathy profile kd_scale = {'A': 1.8, 'R': -4.5, 'N': -3.5, ...} profile = protein.protein_scale(kd_scale, window=7)
Code Patterns
Analyze Multiple Sequences
from Bio import SeqIO from Bio.SeqUtils import gc_fraction def analyze_fasta(filename): results = [] for record in SeqIO.parse(filename, 'fasta'): results.append({ 'id': record.id, 'length': len(record.seq), 'gc': gc_fraction(record.seq) * 100 }) return results
GC Content Distribution (Sliding Windows)
from Bio.SeqUtils import gc_fraction def gc_distribution(seq, window_size=100, step=50): gc_values = [] for i in range(0, len(seq) - window_size + 1, step): window = seq[i:i + window_size] gc_values.append((i, gc_fraction(window) * 100)) return gc_values
GC Skew Plot Data
from Bio.SeqUtils import GC_skew def gc_skew_analysis(seq, window=1000): skew = GC_skew(seq, window=window) positions = list(range(0, len(seq) - window + 1, window)) cumulative = [] total = 0 for s in skew: total += s cumulative.append(total) return positions, skew, cumulative
Full Protein Analysis Report
Goal: Generate a comprehensive summary of protein biophysical properties.
Approach: Compute all key metrics from a single
ProteinAnalysis object and return as a dictionary.
from Bio.SeqUtils.ProtParam import ProteinAnalysis def protein_report(sequence): protein = ProteinAnalysis(str(sequence).replace('*', '')) helix, turn, sheet = protein.secondary_structure_fraction() return { 'length': len(sequence), 'molecular_weight': protein.molecular_weight(), 'isoelectric_point': protein.isoelectric_point(), 'charge_at_pH7': protein.charge_at_pH(7.0), 'instability_index': protein.instability_index(), 'gravy': protein.gravy(), 'aromaticity': protein.aromaticity(), 'helix_fraction': helix, 'turn_fraction': turn, 'sheet_fraction': sheet, }
Dinucleotide Frequencies
from collections import Counter def dinucleotide_freq(seq): seq_str = str(seq) dinucs = [seq_str[i:i+2] for i in range(len(seq_str) - 1)] counts = Counter(dinucs) total = sum(counts.values()) return {di: count / total for di, count in counts.items()}
CpG Observed/Expected Ratio
def cpg_ratio(seq): seq_str = str(seq).upper() cpg = seq_str.count('CG') c = seq_str.count('C') g = seq_str.count('G') expected = (c * g) / len(seq_str) if len(seq_str) > 0 else 0 return cpg / expected if expected > 0 else 0
Property Reference
DNA/RNA Properties
| Property | Function | Notes |
|---|---|---|
| GC content | | Returns fraction (0-1) |
| GC by position | | Total, pos1, pos2, pos3 |
| GC skew | | (G-C)/(G+C) in windows |
| Molecular weight | | In Daltons |
| Melting temp | | Multiple methods |
| IUPAC search | | Handles ambiguity codes |
Protein Properties
| Property | Method | Typical Range |
|---|---|---|
| MW | | Daltons |
| pI | | 0-14 |
| Charge | | Varies |
| Instability | | <40 stable |
| GRAVY | | -2 to +2 |
| Aromaticity | | 0-0.15 |
| Flexibility | | Per-residue list |
Amino Acid Codes
| Function | Input | Output |
|---|---|---|
| 'MetAlaGly' | 'MAG' |
| 'MAG' | 'MetAlaGly' |
Common Errors
| Error | Cause | Solution |
|---|---|---|
in ProteinAnalysis | Non-standard amino acid | Remove X, *, etc. |
| Wrong MW | Wrong seq_type | Specify 'RNA' or 'protein' |
| Invalid Tm | Sequence too short | Use >10 bp for accurate Tm |
| Empty GC_skew | Sequence shorter than window | Reduce window size |
Decision Tree
Need sequence properties? ├── DNA/RNA sequence? │ ├── GC content? → gc_fraction() │ ├── GC at codon positions? → GC123() │ ├── GC skew (replication origin)? → GC_skew() │ ├── Molecular weight? → molecular_weight() │ ├── Melting temperature? → MeltingTemp.Tm_NN() │ └── Search with IUPAC codes? → nt_search() ├── Protein sequence? │ └── Create ProteinAnalysis object │ ├── Size → molecular_weight() │ ├── Charge → isoelectric_point(), charge_at_pH() │ ├── Stability → instability_index() │ ├── Hydrophobicity → gravy() │ ├── Flexibility → flexibility() │ └── Structure → secondary_structure_fraction() └── Convert amino acid codes? └── seq1() / seq3()
Related Skills
- seq-objects - Create Seq objects for property calculation
- sequence-io/sequence-statistics - File-level statistics (N50, totals)
- codon-usage - GC123 for codon position analysis
- transcription-translation - Translate before protein analysis
- alignment-files/bam-statistics - samtools stats for alignment-level GC and quality stats