Claude-scientific-skills gget
Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis. Best for interactive exploration, simple queries. For batch processing or advanced BLAST use biopython; for multi-database Python workflows use bioservices.
git clone https://github.com/K-Dense-AI/scientific-agent-skills
T=$(mktemp -d) && git clone --depth=1 https://github.com/K-Dense-AI/scientific-agent-skills "$T" && mkdir -p ~/.claude/skills && cp -r "$T/scientific-skills/gget" ~/.claude/skills/k-dense-ai-claude-scientific-skills-gget && rm -rf "$T"
scientific-skills/gget/SKILL.mdgget
Overview
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
Installation
Install gget in a clean virtual environment to avoid conflicts:
# Using uv (recommended) uv uv pip install gget # Or using pip uv pip install --upgrade gget # In Python/Jupyter import gget
Quick Start
Basic usage pattern for all modules:
# Command-line gget <module> [arguments] [options] # Python gget.module(arguments, options)
Most modules return:
- Command-line: JSON (default) or CSV with
flag-csv - Python: DataFrame or dictionary
Common flags across modules:
: Save results to file-o/--out
: Suppress progress information-q/--quiet
: Return CSV format (command-line only)-csv
Module Categories
1. Reference & Gene Information
gget ref - Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
Parameters:
: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'species
: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all-w/--which
: Ensembl release number (default: latest)-r/--release
: List available vertebrate species-l/--list_species
: List available invertebrate species-liv/--list_iv_species
: Return only FTP links-ftp
: Download files (requires curl)-d/--download
Examples:
# List available species gget ref --list_species # Get all reference files for human gget ref homo_sapiens # Download only GTF annotation for mouse gget ref -w gtf -d mouse
# Python gget.ref("homo_sapiens") gget.ref("mus_musculus", which="gtf", download=True)
gget search - Gene Search
Locate genes by name or description across species.
Parameters:
: One or more search terms (case-insensitive)searchwords
: Target species (e.g., 'homo_sapiens', 'mouse')-s/--species
: Ensembl release number-r/--release
: Return 'gene' (default) or 'transcript'-t/--id_type
: 'or' (default) finds ANY searchword; 'and' requires ALL-ao/--andor
: Maximum results to return-l/--limit
Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
Examples:
# Search for GABA-related genes in human gget search -s human gaba gamma-aminobutyric # Find specific gene, require all terms gget search -s mouse -ao and pax7 transcription
# Python gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
gget info - Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
Parameters:
: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDsens_ids
: Disable NCBI data retrieval-n/--ncbi
: Disable UniProt data retrieval-u/--uniprot
: Include PDB identifiers (increases runtime)-pdb
Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
Examples:
# Get info for multiple genes gget info ENSG00000034713 ENSG00000104853 ENSG00000170296 # Include PDB IDs gget info ENSG00000034713 -pdb
# Python gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
gget seq - Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
Parameters:
: One or more Ensembl identifiersens_ids
: Fetch amino acid sequences instead of nucleotide-t/--translate
: Return all transcript variants (gene IDs only)-iso/--isoforms
Returns: FASTA format sequences
Examples:
# Get nucleotide sequences gget seq ENSG00000034713 ENSG00000104853 # Get all protein isoforms gget seq -t -iso ENSG00000034713
# Python gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
2. Sequence Analysis & Alignment
gget blast - BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
Parameters:
: Sequence string or path to FASTA/.txt filesequence
: blastn, blastp, blastx, tblastn, tblastx (auto-detected)-p/--program
:-db/--database- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
: Max hits (default: 50)-l/--limit
: E-value cutoff (default: 10.0)-e/--expect
: Enable low complexity filtering-lcf/--low_comp_filt
: Disable MegaBLAST (blastn only)-mbo/--megablast_off
Examples:
# BLAST protein sequence gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR # BLAST from file with specific database gget blast sequence.fasta -db swissprot -l 10
# Python gget.blast("MKWMFK...", database="swissprot", limit=10)
gget blat - BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
Parameters:
: Sequence string or path to FASTA/.txt filesequence
: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)-st/--seqtype
: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)-a/--assembly
Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage
Examples:
# Find genomic location in human gget blat ATCGATCGATCGATCG # Search in different assembly gget blat -a mm39 ATCGATCGATCGATCG
# Python gget.blat("ATCGATCGATCGATCG", assembly="mouse")
gget muscle - Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
Parameters:
: Sequences or path to FASTA/.txt filefasta
: Use Super5 algorithm for faster processing (large datasets)-s5/--super5
Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)
Examples:
# Align sequences from file gget muscle sequences.fasta -o aligned.afa # Use Super5 for large dataset gget muscle large_dataset.fasta -s5
# Python gget.muscle("sequences.fasta", save=True)
gget diamond - Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
Parameters:
- Query: Sequences (string/list) or FASTA file path
: Reference sequences (string/list) or FASTA file path (required)--reference
: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive--sensitivity
: CPU threads (default: 1)--threads
: Save database for reuse--diamond_db
: Enable nucleotide-to-amino acid alignment--translated
Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
Examples:
# Align against reference gget diamond GGETISAWESQME -ref reference.fasta --threads 4 # Save database for reuse gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
3. Structural & Protein Analysis
gget pdb - Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
Parameters:
: PDB identifier (e.g., '7S7U')pdb_id
: Data type (pdb, entry, pubmed, assembly, entity types)-r/--resource
: Assembly, entity, or chain ID-i/--identifier
Returns: PDB format (structures) or JSON (metadata)
Examples:
# Download PDB structure gget pdb 7S7U -o 7S7U.pdb # Get metadata gget pdb 7S7U -r entry
# Python gget.pdb("7S7U", save=True)
gget alphafold - Protein Structure Prediction
Predict 3D protein structures using simplified AlphaFold2.
Setup Required:
# Install OpenMM first uv pip install openmm # Then setup AlphaFold gget setup alphafold
Parameters:
: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modelingsequence
: Recycling iterations (default: 3; recommend 20 for accuracy)-mr/--multimer_recycles
: Apply multimer model to single proteins-mfm/--multimer_for_monomer
: AMBER relaxation for top-ranked model-r/--relax
: Python-only; generate interactive 3D visualization (default: True)plot
: Python-only; include side chains (default: True)show_sidechains
Returns: PDB structure file, JSON alignment error data, optional 3D visualization
Examples:
# Predict single protein structure gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR # Predict multimer with higher accuracy gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization gget.alphafold("MKWMFK...", plot=True, show_sidechains=True) # Multimer prediction gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
gget elm - Eukaryotic Linear Motifs
Predict Eukaryotic Linear Motifs in protein sequences.
Setup Required:
gget setup elm
Parameters:
: Amino acid sequence or UniProt Accsequence
: Indicates sequence is UniProt Acc-u/--uniprot
: Include protein names, organisms, references-e/--expand
: DIAMOND alignment sensitivity (default: "very-sensitive")-s/--sensitivity
: Number of threads (default: 1)-t/--threads
Returns: Two outputs:
- ortholog_df: Linear motifs from orthologous proteins
- regex_df: Motifs directly matched in input sequence
Examples:
# Predict motifs from sequence gget elm LIAQSIGQASFV -o results # Use UniProt accession with expanded info gget elm --uniprot Q02410 -e
# Python ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
4. Expression & Disease Data
gget archs4 - Gene Correlation & Tissue Expression
Query ARCHS4 database for correlated genes or tissue expression data.
Parameters:
: Gene symbol or Ensembl ID (withgene
flag)--ensembl
: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)-w/--which
: 'human' (default) or 'mouse' (tissue data only)-s/--species
: Input is Ensembl ID-e/--ensembl
Returns:
- Correlation mode: Gene symbols, Pearson correlation coefficients
- Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values
Examples:
# Get correlated genes gget archs4 ACE2 # Get tissue expression gget archs4 -w tissue ACE2
# Python gget.archs4("ACE2", which="tissue")
gget cellxgene - Single-Cell RNA-seq Data
Query CZ CELLxGENE Discover Census for single-cell data.
Setup Required:
gget setup cellxgene
Parameters:
(-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)--gene
: Tissue type(s)--tissue
: Specific cell type(s)--cell_type
(-s): 'homo_sapiens' (default) or 'mus_musculus'--species
(-cv): Version ("stable", "latest", or dated)--census_version
(-e): Use Ensembl IDs--ensembl
(-mo): Return metadata only--meta_only- Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type
Returns: AnnData object with count matrices and metadata (or metadata-only dataframes)
Examples:
# Get single-cell data for specific genes and cell types gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad # Metadata only gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
# Python adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
gget enrichr - Enrichment Analysis
Perform ontology enrichment analysis on gene lists using Enrichr.
Parameters:
: Gene symbols or Ensembl IDsgenes
: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')-db/--database
: human (default), mouse, fly, yeast, worm, fish-s/--species
: Background genes for comparison-bkg_l/--background_list
: Save KEGG pathway images with highlighted genes-ko/--kegg_out
: Python-only; generate graphical resultsplot
Database Shortcuts:
- 'pathway' → KEGG_2021_Human
- 'transcription' → ChEA_2016
- 'ontology' → GO_Biological_Process_2021
- 'diseases_drugs' → GWAS_Catalog_2019
- 'celltypes' → PanglaoDB_Augmented_2021
Examples:
# Enrichment analysis for ontology gget enrichr -db ontology ACE2 AGT AGTR1 # Save KEGG pathways gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
# Python with plot gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
gget bgee - Orthology & Expression
Retrieve orthology and gene expression data from Bgee database.
Parameters:
: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported whenens_idtype=expression
: 'orthologs' (default) or 'expression'-t/--type
Returns:
- Orthologs mode: Matching genes across species with IDs, names, taxonomic info
- Expression mode: Anatomical entities, confidence scores, expression status
Examples:
# Get orthologs gget bgee ENSG00000169194 # Get expression data gget bgee ENSG00000169194 -t expression # Multiple genes gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
# Python gget.bgee("ENSG00000169194", type="orthologs")
gget opentargets - Disease & Drug Associations
Retrieve disease and drug associations from OpenTargets.
Parameters:
- Ensembl gene ID (required)
: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions-r/--resource
: Cap results count-l/--limit- Filter arguments (vary by resource):
- drugs:
--filter_disease - pharmacogenetics:
--filter_drug - expression/depmap:
,--filter_tissue
,--filter_anat_sys--filter_organ - interactions:
,--filter_protein_a
,--filter_protein_b--filter_gene_b
- drugs:
Examples:
# Get associated diseases gget opentargets ENSG00000169194 -r diseases -l 5 # Get associated drugs gget opentargets ENSG00000169194 -r drugs -l 10 # Get tissue expression gget opentargets ENSG00000169194 -r expression --filter_tissue brain
# Python gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
gget cbio - cBioPortal Cancer Genomics
Plot cancer genomics heatmaps using cBioPortal data.
Two subcommands:
search - Find study IDs:
gget cbio search breast lung
plot - Generate heatmaps:
Parameters:
: Space-separated cBioPortal study IDs (required)-s/--study_ids
: Space-separated gene names or Ensembl IDs (required)-g/--genes
: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)-st/--stratification
: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)-vt/--variation_type
: Filter by column value (e.g., 'study_id:msk_impact_2017')-f/--filter
: Cache directory (default: ./gget_cbio_cache)-dd/--data_dir
: Output directory (default: ./gget_cbio_figures)-fd/--figure_dir
: Resolution (default: 100)-dpi
: Display plot in window-sh/--show
: Skip download confirmations-nc/--no_confirm
Examples:
# Search for studies gget cbio search esophag ovary # Create heatmap gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
# Python gget.cbio_search(["esophag", "ovary"]) gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
gget cosmic - COSMIC Database
Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
Important: License fees apply for commercial use. Requires COSMIC account credentials.
Parameters:
: Gene name, Ensembl ID, mutation notation, or sample IDsearchterm
: Path to downloaded COSMIC TSV file (required for querying)-ctp/--cosmic_tsv_path
: Maximum results (default: 100)-l/--limit
Database download flags:
: Activate download mode-d/--download_cosmic
: Create version for gget mutate-gm/--gget_mutate
: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)-cp/--cosmic_project
: COSMIC version-cv/--cosmic_version
: Human reference genome (37 or 38)-gv/--grch_version
,--email
: COSMIC credentials--password
Examples:
# First download database gget cosmic -d --email user@example.com --password xxx -cp cancer # Then query gget cosmic EGFR -ctp cosmic_data.tsv -l 10
# Python gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
5. Additional Tools
gget mutate - Generate Mutated Sequences
Generate mutated nucleotide sequences from mutation annotations.
Parameters:
: FASTA file path or direct sequence input (string/list)sequences
: CSV/TSV file or DataFrame with mutation data (required)-m/--mutations
: Mutation column name (default: 'mutation')-mc/--mut_column
: Sequence ID column (default: 'seq_ID')-sic/--seq_id_column
: Mutation ID column-mic/--mut_id_column
: Length of flanking sequences (default: 30 nucleotides)-k/--k
Returns: Mutated sequences in FASTA format
Examples:
# Single mutation gget mutate ATCGCTAAGCT -m "c.4G>T" # Multiple sequences with mutations from file gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
# Python import pandas as pd mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]}) gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
gget gpt - OpenAI Text Generation
Generate natural language text using OpenAI's API.
Setup Required:
gget setup gpt
Important: Free tier limited to 3 months after account creation. Set monthly billing limits.
Parameters:
: Text input for generation (required)prompt
: OpenAI authentication (required)api_key- Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
- Default model: gpt-3.5-turbo (configurable)
Examples:
gget gpt "Explain CRISPR" --api_key your_key_here
# Python gget.gpt("Explain CRISPR", api_key="your_key_here")
gget setup - Install Dependencies
Install/download third-party dependencies for specific modules.
Parameters:
: Module name requiring dependency installationmodule
: Output folder path (elm module only)-o/--out
Modules requiring setup:
- Downloads ~4GB of model parametersalphafold
- Installs cellxgene-census (may not support latest Python)cellxgene
- Downloads local ELM databaseelm
- Configures OpenAI integrationgpt
Examples:
# Setup AlphaFold gget setup alphafold # Setup ELM with custom directory gget setup elm -o /path/to/elm_data
# Python gget.setup("alphafold")
Common Workflows
Workflow 1: Gene Discovery to Sequence Analysis
Find and analyze genes of interest:
# 1. Search for genes results = gget.search(["GABA", "receptor"], species="homo_sapiens") # 2. Get detailed information gene_ids = results["ensembl_id"].tolist() info = gget.info(gene_ids[:5]) # 3. Retrieve sequences sequences = gget.seq(gene_ids[:5], translate=True)
Workflow 2: Sequence Alignment and Structure
Align sequences and predict structures:
# 1. Align multiple sequences alignment = gget.muscle("sequences.fasta") # 2. Find similar sequences blast_results = gget.blast(my_sequence, database="swissprot", limit=10) # 3. Predict structure structure = gget.alphafold(my_sequence, plot=True) # 4. Find linear motifs ortholog_df, regex_df = gget.elm(my_sequence)
Workflow 3: Gene Expression and Enrichment
Analyze expression patterns and functional enrichment:
# 1. Get tissue expression tissue_expr = gget.archs4("ACE2", which="tissue") # 2. Find correlated genes correlated = gget.archs4("ACE2", which="correlation") # 3. Get single-cell data adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell") # 4. Perform enrichment analysis gene_list = correlated["gene_symbol"].tolist()[:50] enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
Workflow 4: Disease and Drug Analysis
Investigate disease associations and therapeutic targets:
# 1. Search for genes genes = gget.search(["breast cancer"], species="homo_sapiens") # 2. Get disease associations diseases = gget.opentargets("ENSG00000169194", resource="diseases") # 3. Get drug associations drugs = gget.opentargets("ENSG00000169194", resource="drugs") # 4. Query cancer genomics data study_ids = gget.cbio_search(["breast"]) gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type") # 5. Search COSMIC for mutations cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
Workflow 5: Comparative Genomics
Compare proteins across species:
# 1. Get orthologs orthologs = gget.bgee("ENSG00000169194", type="orthologs") # 2. Get sequences for comparison human_seq = gget.seq("ENSG00000169194", translate=True) mouse_seq = gget.seq("ENSMUSG00000026091", translate=True) # 3. Align sequences alignment = gget.muscle([human_seq, mouse_seq]) # 4. Compare structures human_structure = gget.pdb("7S7U") mouse_structure = gget.alphafold(mouse_seq)
Workflow 6: Building Reference Indices
Prepare reference data for downstream analysis (e.g., kallisto|bustools):
# 1. List available species gget ref --list_species # 2. Download reference files gget ref -w gtf -w cdna -d homo_sapiens # 3. Build kallisto index kallisto index -i transcriptome.idx transcriptome.fasta # 4. Download genome for alignment gget ref -w dna -d homo_sapiens
Best Practices
Data Retrieval
- Use
to control result sizes for large queries--limit - Save results with
for reproducibility-o/--out - Check database versions/releases for consistency across analyses
- Use
in production scripts to reduce output--quiet
Sequence Analysis
- For BLAST/BLAT, start with default parameters, then adjust sensitivity
- Use
withgget diamond
for faster local alignment--threads - Save DIAMOND databases with
for repeated queries--diamond_db - For multiple sequence alignment, use
for large datasets-s5/--super5
Expression and Disease Data
- Gene symbols are case-sensitive in cellxgene (e.g., 'PAX7' vs 'Pax7')
- Run
before first use of alphafold, cellxgene, elm, gptgget setup - For enrichment analysis, use database shortcuts for convenience
- Cache cBioPortal data with
to avoid repeated downloads-dd
Structure Prediction
- AlphaFold multimer predictions: use
for higher accuracy-mr 20 - Use
flag for AMBER relaxation of final structures-r - Visualize results in Python with
plot=True - Check PDB database first before running AlphaFold predictions
Error Handling
- Database structures change; update gget regularly:
uv pip install --upgrade gget - Process max ~1000 Ensembl IDs at once with gget info
- For large-scale analyses, implement rate limiting for API queries
- Use virtual environments to avoid dependency conflicts
Output Formats
Command-line
- Default: JSON
- CSV: Add
flag-csv - FASTA: gget seq, gget mutate
- PDB: gget pdb, gget alphafold
- PNG: gget cbio plot
Python
- Default: DataFrame or dictionary
- JSON: Add
parameterjson=True - Save to file: Add
or specifysave=Trueout="filename" - AnnData: gget cellxgene
Resources
This skill includes reference documentation for detailed module information:
references/
- Comprehensive parameter reference for all modulesmodule_reference.md
- Information about queried databases and their update frequenciesdatabase_info.md
- Extended workflow examples and use casesworkflows.md
For additional help:
- Official documentation: https://pachterlab.github.io/gget/
- GitHub issues: https://github.com/pachterlab/gget/issues
- Citation: Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836