Claude-scientific-skills rowan
Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure.
git clone https://github.com/K-Dense-AI/scientific-agent-skills
T=$(mktemp -d) && git clone --depth=1 https://github.com/K-Dense-AI/scientific-agent-skills "$T" && mkdir -p ~/.claude/skills && cp -r "$T/scientific-skills/rowan" ~/.claude/skills/k-dense-ai-claude-scientific-skills-rowan && rm -rf "$T"
scientific-skills/rowan/SKILL.mdRowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows
Overview
Rowan is a cloud-native workflow platform for molecular simulation, medicinal chemistry, and structure-based design. Its Python API exposes a unified interface for small-molecule modeling, property prediction, docking, molecular dynamics, and AI structure workflows.
Use Rowan when you want to run medicinal-chemistry or molecular-design workflows programmatically without maintaining local HPC infrastructure, GPU provisioning, or a collection of separate modeling tools. Rowan handles all infrastructure, result management, and computation scaling.
When to use Rowan
Rowan is a good fit for:
- Quantum chemistry, semiempirical methods, or neural network potentials
- Batch property prediction (pKa, descriptors, permeability, solubility)
- Conformer and tautomer ensemble generation
- Docking workflows (single-ligand, analogue series, pose refinement)
- Protein-ligand cofolding and MSA generation
- Multi-step chemistry pipelines (e.g., tautomer search → docking → pose analysis)
- Batch medicinal-chemistry campaigns where you need consistent, scalable infrastructure
Rowan is not the right fit for:
- Simple molecular I/O (use RDKit directly)
- Post-HF ab initio quantum chemistry or relativistic calculations
Access and pricing model
Rowan uses a credit-based usage model. All users, including free-tier users, can create API keys and use the Python API.
Free-tier access
- Access to all Rowan core workflows
- 20 credits per week
- 500 signup credits
Pricing and credit consumption
Credits are consumed according to compute type:
- CPU: 1 credit per minute
- GPU: 3 credits per minute
- H100/H200 GPU: 7 credits per minute
Purchased credits are priced per credit and remain valid for up to one year from purchase.
Typical cost estimates
| Workflow | Typical Runtime | Estimated Credits | Notes |
|---|---|---|---|
| Descriptors | <1 min | 0.5–2 | Lightweight, good for triage |
| pKa (single transition) | 2–5 min | 2–5 | Depends on molecule size |
| MacropKa (pH 0–14) | 5–15 min | 5–15 | Broader sampling, higher cost |
| Conformer search | 3–10 min | 3–10 | Ensemble quality matters |
| Tautomer search | 2–5 min | 2–5 | Heterocyclic systems |
| Docking (single ligand) | 5–20 min | 5–20 | Depends on pocket size, refinement |
| Analogue docking series (10–50 ligands) | 30–120 min | 30–100+ | Shared reference frame |
| MSA generation | 5–30 min | 5–30 | Sequence length dependent |
| Protein-ligand cofolding | 15–60 min | 20–50+ | AI structure prediction, GPU-heavy |
Quick start
uv pip install rowan-python
import rowan rowan.api_key = "your_api_key_here" # or set ROWAN_API_KEY env var # Submit a descriptors workflow — completes in under a minute wf = rowan.submit_descriptors_workflow("CC(=O)Oc1ccccc1C(=O)O", name="aspirin") result = wf.result() print(result.descriptors['MW']) # 180.16 print(result.descriptors['SLogP']) # 1.19 print(result.descriptors['TPSA']) # 59.44
If that prints without error, you're set up correctly.
Installation
uv pip install rowan-python # or: pip install rowan-python
User and webhook management
Authentication
Set an API key via environment variable (recommended):
export ROWAN_API_KEY="your_api_key_here"
Or set directly in Python:
import rowan rowan.api_key = "your_api_key_here"
Verify authentication:
import rowan user = rowan.whoami() # Returns user info if authenticated print(f"User: {user.email}") print(f"Credits available: {user.credits_available_string}")
Webhook secret management
For webhook signature verification, manage secrets through your user account:
import rowan # Get your current webhook secret (returns None if none exists) secret = rowan.get_webhook_secret() if secret is None: secret = rowan.create_webhook_secret() print(f"Secret key: {secret.secret}") # Rotate your secret (invalidates old, creates new) # Use this periodically for security new_secret = rowan.rotate_webhook_secret() print(f"New secret created (old secret disabled): {new_secret.secret}") # Verify incoming webhook signatures is_valid = rowan.verify_webhook_secret( request_body=b"...", # Raw request body (bytes) signature="X-Rowan-Signature", # From request header secret=secret.secret )
Molecule input formats
Rowan accepts molecules in the following formats:
- SMILES (preferred):
,"CCO""c1ccccc1O" - SMARTS patterns (for some workflows): subset of SMARTS for substructure matching
- InChI (if supported in your API version):
"InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"
The API will validate input and raise a
rowan.ValidationError if a molecule cannot be parsed. Always use canonicalized SMILES for reproducibility.
Tip: Use RDKit to validate SMILES before submission:
from rdkit import Chem smiles = "CCO" mol = Chem.MolFromSmiles(smiles) if mol is None: raise ValueError(f"Invalid SMILES: {smiles}")
Core usage pattern
Most Rowan tasks follow the same three-step pattern:
- Submit a workflow
- Wait for completion (with optional streaming)
- Retrieve typed results with convenience properties
import rowan # 1. Submit — use the specific workflow function (not the generic submit_workflow) workflow = rowan.submit_descriptors_workflow( "CC(=O)Oc1ccccc1C(=O)O", name="aspirin descriptors", ) # 2. & 3. Wait and retrieve result = workflow.result() # Blocks until done (default: wait=True, poll_interval=5) print(result.data) # Raw dict print(result.descriptors['MW']) # 180.16 — use result.descriptors dict, not result.molecular_weight
For long-running workflows, use streaming:
for partial in workflow.stream_result(poll_interval=5): print(f"Progress: {partial.complete}%") print(partial.data)
result() vs. stream_result()
| Pattern | Use When | Duration |
|---|---|---|
| You can wait for the full result | <5 min typical |
| You want progress feedback or need early partial results | >5 min, or interactive use |
Guideline: Use
result() for descriptors, pKa. Use stream_result() for conformer search, docking, cofolding.
Working with results
Rowan's API includes typed workflow result objects with convenience properties.
Using typed properties and .data
Results have two access patterns:
- Convenience properties (recommended first):
,result.descriptors
,result.best_poseresult.conformer_energies - Raw fallback:
— raw dictionary from the APIresult.data
Example:
result = rowan.submit_descriptors_workflow( "CCO", name="ethanol", ).result() # Convenience property (returns dict of all descriptors): print(result.descriptors['MW']) # 46.042 print(result.descriptors['SLogP']) # -0.001 print(result.descriptors['TPSA']) # 57.96 # Raw data fallback (descriptors are nested under 'descriptors' key): print(result.data['descriptors']) # {'MW': 46.042, 'SLogP': -0.001, 'TPSA': 57.96, 'nHBDon': 1.0, 'nHBAcc': 1.0, ...}
Note:
DescriptorsResult does not have a molecular_weight property. Descriptor keys use short names (MW, SLogP, nHBDon) not verbose names.
Cache invalidation
Some result properties are lazily loaded (e.g., conformer geometries, protein structures). To refresh:
result.clear_cache() new_structures = result.conformer_molecules # Refetched
Projects, folders, and organization
For nontrivial campaigns, use projects and folders to keep work organized.
Projects
import rowan # Create a project project = rowan.create_project(name="CDK2 lead optimization") rowan.set_project("CDK2 lead optimization") # All subsequent workflows go into this project wf = rowan.submit_descriptors_workflow("CCO", name="test compound") # Retrieve later project = rowan.retrieve_project("CDK2 lead optimization") workflows = rowan.list_workflows(project=project, size=50)
Folders
# Create a hierarchical folder structure folder = rowan.create_folder(name="docking/batch_1/screening") wf = rowan.submit_docking_workflow( # ... docking params ... folder=folder, name="compound_001", ) # List workflows in a folder results = rowan.list_workflows(folder=folder)
Workflow decision trees
pKa vs. MacropKa
Use microscopic pKa when:
- You need the pKa of a single ionizable group
- You're interested in acid–base transitions and protonation thermodynamics
- The molecule has one or two ionizable sites
- Speed is critical (faster, fewer credits)
Use macropKa when:
- You need pH-dependent behavior across a physiologically relevant range (e.g., 0–14)
- You want aggregated charge and protonation-state populations across pH
- The molecule has multiple ionizable groups with coupled protonation
- You need downstream properties like aqueous solubility at different pH
Example decision:
Phenol (pKa ~10): Use microscopic pKa Amine (pKa ~9–10): Use microscopic pKa Multi-ionizable drug (N, O, acidic group): Use macropKa ADME assessment across GI pH: Use macropKa
Conformer search vs. tautomer search
Use conformer search when:
- A single tautomeric form is known
- You need a diverse 3D ensemble for docking, MD, or SAR analysis
- Rotatable bonds dominate the chemical space
Use tautomer search when:
- Tautomeric equilibrium is uncertain (e.g., heterocycles, keto–enol systems)
- You need to model all relevant protonation isomers
- Downstream calculations (docking, pKa) depend on tautomeric form
Combined workflow:
# Step 1: Find best tautomer taut_wf = rowan.submit_tautomer_search_workflow( initial_molecule="O=c1[nH]ccnc1", name="imidazole tautomers", ) best_taut = taut_wf.result().best_tautomer # Step 2: Generate conformers from best tautomer conf_wf = rowan.submit_conformer_search_workflow( initial_molecule=best_taut, name="imidazole conformers", )
Docking vs. analogue docking vs. cofolding
| Workflow | Use When | Input | Output |
|---|---|---|---|
| Docking | Single ligand, known pocket | Protein + SMILES + pocket coords | Pose, score, dG |
| Analogue docking | 5–100+ related compounds | Protein + SMILES list + reference ligand | All poses, reference-aligned |
| Protein-ligand cofolding | Sequence + ligand, no crystal structure | Protein sequence + SMILES | ML-predicted bound complex |
Common workflow categories
1. Descriptors
A lightweight entry point for batch triage, SAR, or exploratory scripts.
wf = rowan.submit_descriptors_workflow( "CC(=O)Oc1ccccc1C(=O)O", # positional arg, accepts SMILES string name="aspirin descriptors", ) result = wf.result() print(result.descriptors['MW']) # 180.16 print(result.descriptors['SLogP']) # 1.19 print(result.descriptors['TPSA']) # 59.44 print(result.data['descriptors']) # {'MW': 180.16, 'SLogP': 1.19, 'TPSA': 59.44, 'nHBDon': 1.0, 'nHBAcc': 4.0, ...}
Common descriptor keys:
| Key | Description | Typical drug range |
|---|---|---|
| Molecular weight (Da) | <500 (Lipinski) |
| Calculated LogP (lipophilicity) | -2 to +5 |
| Topological polar surface area (Ų) | <140 for oral bioavailability |
| H-bond donor count | ≤5 (Lipinski) |
| H-bond acceptor count | ≤10 (Lipinski) |
| Rotatable bond count | <10 for oral drugs |
| Ring count | — |
| Heavy atom count | — |
| Estimated aqueous solubility (LogS) | >-4 preferred |
| Lipinski Ro5 pass (1.0) or fail (0.0) | — |
The result contains hundreds of additional molecular descriptors (BCUT, GETAWAY, WHIM, etc.); access any via
result.descriptors['key'].
2. Microscopic pKa
For protonation-state energetics and acid/base behavior of a specific structure.
Two methods are available:
| Method | Input | Speed | Covers | Use when |
|---|---|---|---|---|
| SMILES string | Fast | Deprotonation only (anionic conjugate bases) | Acidic groups only; quick screening |
| SMILES string | Fast | Acid + base (full protonation/deprotonation) | Most drug-like molecules; preferred SMILES method |
(default) | 3D molecule object | Slower, higher accuracy | Acid + base | You already have a 3D structure (e.g. from conformer search) |
# Fast path: SMILES input with full acid+base coverage (use starling method when available) wf = rowan.submit_pka_workflow( initial_molecule="c1ccccc1O", # phenol SMILES; param is initial_molecule, not initial_smiles method="starling", # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only name="phenol pKa", ) result = wf.result() print(result.strongest_acid) # 9.81 (pKa of the most acidic site) print(result.conjugate_bases) # list of {pka, smiles, atom_index, ...} per deprotonatable site
3. MacropKa
For pH-dependent protonation behavior across a range.
wf = rowan.submit_macropka_workflow( initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32", # imidazole min_pH=0, max_pH=14, min_charge=-2, # default max_charge=2, # default compute_aqueous_solubility=True, # default name="imidazole macropKa", ) result = wf.result() print(result.pka_values) # list of pKa values print(result.logd_by_ph) # dict of {pH: logD} print(result.aqueous_solubility_by_ph) # dict of {pH: solubility} print(result.isoelectric_point) # isoelectric point print(result.data) # {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...}
4. Conformer search
For 3D ensemble generation when ensemble quality matters.
wf = rowan.submit_conformer_search_workflow( initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12", num_conformers=50, # Optional: override default name="conformer search", ) result = wf.result() print(result.conformer_energies) # [0.0, 1.2, 2.5, ...] print(result.conformer_molecules) # List of 3D molecules print(result.best_conformer) # Lowest-energy conformer
5. Tautomer search
For heterocycles and systems where tautomer state affects downstream modeling.
wf = rowan.submit_tautomer_search_workflow( initial_molecule="O=c1[nH]ccnc1", # or keto tautomer name="imidazolone tautomers", ) result = wf.result() print(result.best_tautomer) # Most stable SMILES string print(result.tautomers) # List of tautomeric SMILES print(result.molecules) # List of molecule objects
6. Docking
For protein-ligand docking with optional pose refinement and conformer generation.
# Upload protein once, reuse in multiple workflows protein = rowan.upload_protein( name="CDK2", file_path="cdk2.pdb", ) # Define binding pocket pocket = { "center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0], } # Submit docking wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule="CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", do_pose_refinement=True, do_conformer_search=True, name="lead docking", ) result = wf.result() print(result.scores) # Docking scores (kcal/mol) print(result.best_pose) # Mol object with 3D coordinates print(result.data) # Raw result dict
Protein preparation tips:
- PDB files should be reasonably clean (remove water/heteroatoms unless intended)
- Use the same protein object across a docking series for consistency
- If you have a PDB ID, use
insteadrowan.create_protein_from_pdb_id()
7. Analogue docking
For placing a compound series into a shared binding context.
# Analogue series (e.g., SAR campaign) analogues = [ "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # reference "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # chloro "CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1", # methoxy "CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro ] wf = rowan.submit_analogue_docking_workflow( analogues=analogues, initial_molecule=analogues[0], # Reference ligand protein=protein, pocket=pocket, name="SAR series docking", ) result = wf.result() print(result.analogue_scores) # List of scores for each analogue print(result.best_poses) # List of poses
8. MSA generation
For multiple-sequence alignment (useful for downstream cofolding).
wf = rowan.submit_msa_workflow( initial_protein_sequences=[ "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP" ], output_formats=["colabfold", "chai", "boltz"], name="target MSA", ) result = wf.result() result.download_files() # Downloads alignments to disk
9. Protein-ligand cofolding
For AI-based bound-complex prediction when no crystal structure is available.
wf = rowan.submit_protein_cofolding_workflow( initial_protein_sequences=[ "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP" ], initial_smiles_list=[ "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" ], name="protein-ligand cofolding", ) result = wf.result() print(result.predictions) # List of predicted structures print(result.messages) # Model metadata/warnings predicted_structure = result.get_predicted_structure() predicted_structure.write("predicted_complex.pdb")
All supported workflow types
All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization.
Core molecular modeling workflows
| Workflow | Function | When to use |
|---|---|---|
| Descriptors | | First-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter |
| pKa | | Single ionizable group; need protonation thermodynamics |
| MacropKa | | Multi-ionizable drugs; pH-dependent charge/LogD/solubility |
| Conformer Search | | 3D ensemble for docking, MD, or SAR; known tautomer |
| Tautomer Search | | Heterocycles, keto–enol; uncertain tautomeric form |
| Solubility | | Aqueous or solvent-specific solubility prediction |
| Membrane Permeability | | Caco-2, PAMPA, BBB, plasma permeability |
| ADMET | | Broad drug-likeness and ADMET property sweep |
Structure-based design workflows
| Workflow | Function | When to use |
|---|---|---|
| Docking | | Single ligand, known binding pocket |
| Analogue Docking | | SAR series (5–100+ compounds) in a shared pocket |
| Batch Docking | | Fast library screening; large compound sets |
| Protein MD | | Long-timescale dynamics; conformational sampling |
| Pose Analysis MD | | MD refinement of a docking pose |
| Protein Cofolding | | No crystal structure; AI-predicted bound complex |
| Protein Binder Design | | De novo binder generation against a protein target |
Advanced computational chemistry
| Workflow | Function | When to use |
|---|---|---|
| Basic Calculation | | QM/ML geometry optimization or single-point energy |
| Electronic Properties | | Dipole, partial charges, HOMO-LUMO, ESP |
| BDE | | Bond dissociation energies; metabolic soft-spot prediction |
| Redox Potential | | Oxidation/reduction potentials |
| Spin States | | Spin-state energy ordering for organometallics/radicals |
| Strain | | Conformational strain relative to global minimum |
| Scan | | PES scans; torsion profiles |
| Multistage Optimization | | Progressive optimization across levels of theory |
Reaction chemistry
| Workflow | Function | When to use |
|---|---|---|
| Double-Ended TS Search | | Transition state between two known structures |
| IRC | | Confirm TS connectivity; intrinsic reaction coordinate |
Advanced properties
| Workflow | Function | When to use |
|---|---|---|
| NMR | | Predicted 1H/13C chemical shifts for structure verification |
| Ion Mobility | | Collision cross-section (CCS) for MS method development |
| Hydrogen Bond Strength | | H-bond donor/acceptor strength for formulation/solubility |
| Fukui | | Site reactivity indices for electrophilic/nucleophilic attack |
| Interaction Energy Decomposition | | Fragment-level interaction analysis |
Binding free energy
| Workflow | Function | When to use |
|---|---|---|
| RBFE/FEP | | Relative ΔΔG for congeneric series |
| RBFE Graph | | Build and optimize an RBFE perturbation network |
Sequence and structural biology
| Workflow | Function | When to use |
|---|---|---|
| MSA | | Multiple sequence alignment for cofolding (ColabFold, Chai, Boltz) |
| Solvent-Dependent Conformers | | Solvation-aware conformer ensembles |
Batch submission and retrieval
For libraries or analogue series, submit in a loop using the specific workflow function. The generic
rowan.batch_submit_workflow() and rowan.submit_workflow() functions currently return 422 errors from the API — use the named functions (submit_descriptors_workflow, submit_pka_workflow, etc.) instead.
Submit a batch
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"] names = ["ethanol", "acetic acid", "phenol"] workflows = [ rowan.submit_descriptors_workflow(smi, name=name) for smi, name in zip(smileses, names) ] print(f"Submitted {len(workflows)} workflows")
Poll batch status
statuses = rowan.batch_poll_status([wf.uuid for wf in workflows]) # Returns aggregate counts — not per-UUID: # {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...} if statuses["complete"] == statuses["total"]: print("All workflows done") elif statuses["failed"] > 0: print(f"{statuses['failed']} workflows failed")
Retrieve and collect results
results = [] for wf in workflows: try: result = wf.result() results.append(result.data) except rowan.WorkflowError as e: print(f"Workflow {wf.uuid} failed: {e}") # Optionally aggregate into DataFrame import pandas as pd df = pd.DataFrame(results)
Non-blocking / fire-and-check pattern
For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process.
Session 1 — submit and save UUIDs:
import rowan, json rowan.api_key = "..." smileses = ["CCO", "CC(=O)O", "c1ccccc1O"] workflows = [ rowan.submit_descriptors_workflow(smi, name=f"compound_{i}") for i, smi in enumerate(smileses) ] # Save UUIDs to disk (or a database) uuids = [wf.uuid for wf in workflows] with open("workflow_uuids.json", "w") as f: json.dump(uuids, f) print("Submitted. Check back later.")
Session 2 — check status and collect results when ready:
import rowan, json rowan.api_key = "..." with open("workflow_uuids.json") as f: uuids = json.load(f) results = [] for uuid in uuids: wf = rowan.retrieve_workflow(uuid) if wf.done(): result = wf.result(wait=False) results.append({"uuid": uuid, "data": result.data}) else: print(f"{uuid}: still running ({wf.status})") print(f"Collected {len(results)} completed results")
Webhooks and asynchronous workflows
For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete.
Setting up webhooks
Every workflow submission function accepts a
webhook_url parameter:
wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule="CCO", webhook_url="https://myserver.com/rowan_callback", name="docking with webhook", ) print(f"Workflow submitted. Result will be POSTed to webhook when complete.")
Webhook URLs can be passed to any specific workflow function (
submit_docking_workflow(), submit_pka_workflow(), submit_descriptors_workflow(), etc.).
Webhook authentication with secrets
Rowan supports webhook signature verification to ensure requests are authentic. You'll need to:
- Create or retrieve a webhook secret:
import rowan # Create a new webhook secret secret = rowan.create_webhook_secret() print(f"Your webhook secret: {secret.secret}") # Or retrieve an existing secret secret = rowan.get_webhook_secret() # Rotate your secret (invalidates old one, creates new) new_secret = rowan.rotate_webhook_secret()
- Verify incoming webhook requests:
import rowan import hmac import json def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool: """Verify the HMAC-SHA256 signature of a webhook request.""" return rowan.verify_webhook_secret(request_body, signature, secret)
Webhook payload and signature
When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header:
X-Rowan-Signature: <HMAC-SHA256 signature>
The request body contains the complete workflow result:
{ "workflow_uuid": "wf_12345abc", "workflow_type": "docking", "workflow_name": "lead docking", "status": "COMPLETED_OK", "created_at": "2025-04-01T12:00:00Z", "completed_at": "2025-04-01T12:15:30Z", "data": { "scores": [-8.2, -8.0, -7.9], "best_pose": {...}, "metadata": {...} } }
Example webhook handler with signature verification (FastAPI)
from fastapi import FastAPI, Request, HTTPException import rowan import json app = FastAPI() _ws = rowan.get_webhook_secret() or rowan.create_webhook_secret() webhook_secret = _ws.secret @app.post("/rowan_callback") async def handle_rowan_webhook(request: Request): # Get request body and signature body = await request.body() signature = request.headers.get("X-Rowan-Signature") if not signature: raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header") # Verify signature if not rowan.verify_webhook_secret(body, signature, webhook_secret): raise HTTPException(status_code=401, detail="Invalid webhook signature") # Parse and process payload = json.loads(body) wf_uuid = payload["workflow_uuid"] status = payload["status"] if status == "COMPLETED_OK": print(f"Workflow {wf_uuid} succeeded!") result_data = payload["data"] # Process result, update database, trigger next workflow, etc. elif status == "FAILED": print(f"Workflow {wf_uuid} failed!") # Handle failure # Respond quickly to prevent retries return {"status": "received"}
Webhook best practices
- Always verify signatures using
to ensure requests are from Rowanrowan.verify_webhook_secret() - Respond quickly (< 5 seconds); offload heavy processing to async tasks or background jobs
- Implement idempotency: workflows may retry; handle duplicate payloads gracefully using
workflow_uuid - Log all events for debugging and audit trails
- Use for long campaigns: webhooks shine with 50+ workflows; for small jobs, polling with
is simplerresult() - Rotate secrets regularly using
for securityrowan.rotate_webhook_secret() - Return 2xx status to confirm receipt; Rowan may retry on 5xx errors
Protein utilities
Upload proteins
# From local PDB file protein = rowan.upload_protein( name="egfr_kinase_domain", file_path="egfr_kinase.pdb", ) # From PDB database protein_from_pdb = rowan.create_protein_from_pdb_id( name="CDK2 (1M17)", code="1M17", ) # Retrieve previously uploaded protein protein = rowan.retrieve_protein("protein-uuid") # List all proteins my_proteins = rowan.list_proteins()
Protein preparation guidance
- File format: PDB, mmCIF (Rowan auto-detects)
- Water molecules: Rowan usually keeps relevant water; remove bulk water beforehand if desired
- Heteroatoms: Cofactors, ions, and bound ligands are usually preserved; remove unwanted heteroatoms before upload
- Multi-chain proteins: Fully supported
- Resolution: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions
- Validation: Rowan validates PDB syntax; severely malformed files may be rejected
End-to-end example: Lead optimization campaign
This example demonstrates a realistic workflow for optimizing a hit compound:
import rowan import pandas as pd # 1. Create a project and folder for organization project = rowan.create_project(name="CDK2 Hit Optimization") rowan.set_project("CDK2 Hit Optimization") folder = rowan.create_folder(name="round_1_tautomers_and_pka") # 2. Load hit compound and analogues hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" # Known hit analogues = [ "CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1", # Remove F "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # Cl instead of F "CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # Propyl instead of ethyl ] # 3. Determine best tautomers (just in case) print("Searching tautomeric forms...") taut_workflows = [ rowan.submit_tautomer_search_workflow( smi, name=f"analog_{i}", folder=folder, ) for i, smi in enumerate(analogues) ] best_tautomers = [] for wf in taut_workflows: result = wf.result() best_tautomers.append(result.best_tautomer) # 4. Predict pKa and basic properties for all analogues print("Predicting pKa and properties...") pka_workflows = [ rowan.submit_pka_workflow( smi, method="chemprop_nevolianis2025", name=f"pka_{i}", folder=folder, ) for i, smi in enumerate(best_tautomers) ] descriptor_workflows = [ rowan.submit_descriptors_workflow(smi, name=f"desc_{i}", folder=folder) for i, smi in enumerate(best_tautomers) ] # 5. Collect results pka_results = [] for wf in pka_workflows: try: result = wf.result() pka_results.append({ "compound": wf.name, "pka": result.strongest_acid, # pKa of the strongest acid site "uuid": wf.uuid, }) except rowan.WorkflowError as e: print(f"pKa prediction failed for {wf.name}: {e}") descriptor_results = [] for wf in descriptor_workflows: try: result = wf.result() desc = result.descriptors descriptor_results.append({ "compound": wf.name, "mw": desc.get("MW"), "logp": desc.get("SLogP"), "hba": desc.get("nHBAcc"), "hbd": desc.get("nHBDon"), "uuid": wf.uuid, }) except rowan.WorkflowError as e: print(f"Descriptor calculation failed for {wf.name}: {e}") # 6. Merge and summarize df_pka = pd.DataFrame(pka_results) df_desc = pd.DataFrame(descriptor_results) df = df_pka.merge(df_desc, on="compound", how="outer") print("\n=== Preliminary SAR ===") print(df.to_string()) # 7. Select promising compound for docking # compound names are "pka_0", "pka_1", etc. — extract index to look up SMILES top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1]) top_smiles = best_tautomers[top_idx] print(f"\nProceeding with docking: {top_smiles}") # 8. Docking campaign protein = rowan.create_protein_from_pdb_id(name="CDK2_1CKP", code="1CKP") pocket = {"center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0]} docking_wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule=top_smiles, do_pose_refinement=True, name=f"docking_{top_compound}", ) dock_result = docking_wf.result() print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol") print(f"Best pose saved to: best_pose.pdb") dock_result.best_pose.write("best_pose.pdb")
Error handling and troubleshooting
Common errors and solutions
import rowan # Error 1: Invalid SMILES try: wf = rowan.submit_descriptors_workflow("CCCC(CC", name="bad smiles") # Invalid except rowan.ValidationError as e: print(f"Invalid SMILES: {e}") # Solution: Use RDKit to validate before submission from rdkit import Chem smi = Chem.MolToSmiles(Chem.MolFromSmiles(smi)) # Error 2: API key not set try: wf = rowan.submit_descriptors_workflow("CCO") except rowan.AuthenticationError: print("API key not found. Set ROWAN_API_KEY env var or call rowan.api_key = '...'") # Error 3: Insufficient credits try: wf = rowan.submit_protein_cofolding_workflow(...) except rowan.InsufficientCreditsError as e: print(f"Not enough credits: {e}. Purchase more or reduce job size.") # Error 4: Workflow failed (bad molecule, etc.) try: wf = rowan.submit_docking_workflow(...) result = wf.result() except rowan.WorkflowError as e: print(f"Workflow failed: {e}") # Check wf.status for details print(f"Status: {wf.status}") # Error 5: Workflow not yet done — poll manually result = wf.result(wait=True, poll_interval=5) # waits and polls every 5s # Or check status without blocking: if not wf.done(): print("Workflow still running. Call wf.result() again later.")
Debugging tips
- Check workflow status:
, checkwf.status
, or callwf.done()wf.get_status() - Inspect raw result:
instead of convenience propertiesresult.data - Re-run failed workflow: Save UUIDs and retry with
rowan.retrieve_workflow(uuid) - Validate molecules beforehand: Use RDKit or Chemaxon before batch submission
Recommended usage patterns
- Prefer Rowan-native workflows over low-level assembly when they exist
- Use projects and folders for any nontrivial campaign (>5 workflows)
- Use
to block until complete (default:result()
)wait=True, poll_interval=5 - Use typed result properties first, fall back to
for unmapped fields.data - Use batch submission for compound libraries or analogue series
- Chain workflows for multi-step chemistry campaigns:
(ADME assessment)pKa → macropKa → permeability
(pose refinement)tautomer search → docking → pose-analysis MD
(AI structure prediction)MSA generation → protein-ligand cofolding
- Use webhooks for long-running campaigns (>50 workflows) or asynchronous pipelines
- Use streaming for interactive feedback on large conformer/docking searches
Summary
Use Rowan when your workflow requires cloud execution for molecular-design tasks, especially when you want one unified API and consistent result handling across small-molecule modeling, proteins, docking, ADME prediction, and ML structure generation.
Rowan is a molecular-design workflow platform, not just a remote chemistry engine. It handles infrastructure scaling, result persistence, and multi-step pipeline orchestration so you can focus on science.